• Newbie
Rekombinantni Zair Ebolavirusni nukleoprotein, djelomičan

Rekombinantni Zair Ebolavirusni nukleoprotein, djelomičan

Buyers rating:
KM 27.15

Dostupnost

Gene Name : NP; Protein N. Syn Name : nukleoprotein; nukleoprotein; nukleokapsidni protein; Protein N. izvor : E Coli ili kvasac ili Bakulovirus ili ćelija sisara; *Čistoća : >90%(SDS-PAGE). Informacije o oznakama : njegov tagged. Vrste : Zair ebolavirus (soj Mayinga-76) (ZEBOV) (virus Ebole Zair). Pufer za skladištenje : 20mm Tris-HCl, 0.5 M Na Cl, PH 8.0, 50% glicerol; *Seq Pos : 488-739. Besplatno-8 GB-USBDrive za ovu stavku. Predmet je za istraživačku upotrebu. Nije za dijagnostičku/terapijsku proceduru. * Seq : LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ; * Skladištenje : Čuvati na -20 stepeni C, za produženo skladištenje, čuvati na -20 stepeni C ili -80 stepeni C. napomene : ne preporučuje se ponovljeno zamrzavanje i odmrzavanje. Čuvajte radne alikvote na 4 stepena C do jedne sedmice.* Pristupanje# : NP_066243.1; NC_002549.1; P18272; *Opis : Inkapsidira genom, štiteći ga od nukleaza. Inkapsidirana genomska RNK naziva se nukleokapsid i služi kao šablon za transkripciju i replikaciju. Tokom replikacije, inkapsidacija putem NP je povezana sa sintezom RNK, a svi replikativni proizvodi su otporni na nukleaze.

Deklarirane specifikacije

Dopuna robe

Rekombinantna Actinidia deliciosa Polygalacturonase
  • Newbie
Ocjena robe:

Rekombinantna Actinidia deliciosa Polygalacturonase

Gene Name : str Vrste : Actinidia deliciosa (kivi); pufer za skladištenje : pufer na bazi Trisa,50% glicerol Seq Pos : 28467 Skladištenje : Čuvati na 20 stepeni C, za produženo skladišt

KM 2.33