• Newbie
Rekombinantna Oryza sativa subsp. indica kation transporter HKT8

Rekombinantna Oryza sativa subsp. indica kation transporter HKT8

Buyers rating:
KM 2.00

Dostupnost

Gene Name : HKT8; HKT1.5, SKC1 ; Os I_001542; HKT1.5; SKC1; Os HKT8. Syn Name : rekombinantni kation transporter HKT8 (HKT8); kation transporter HKT8; Os HKT8; HKT1;5. HKT1; 5. Izvor : E Coli ili kvas. Čistoća : >90%; *informacije o oznakama : njegov tagged; *vrsta : Oryza sativa subsp. indica (Rice). Pufer za skladištenje : PBS p H 7,4, 50% glicerol; *Seq Pos : 1-554. Skladištenje : Čuvati na -20 stepeni C. za prošireno Skladištenje, Čuvati na -20 ili -80 stepeni C. besplatno-8 GB-USBDrive za ovu stavku. Predmet je za istraživačku upotrebu. Nije za dijagnostičku/terapijsku proceduru. * Obrazac : ova stavka zahtijeva prilagođenu proizvodnju, a vrijeme isporuke je između 5-9 sedmica. Možemo proizvesti po mjeri u skladu sa vašim specifikacijama.; * Dalje : MSSLDATTPRYDEFKRIYHLFLFHAHPFWLQLLYFLFISLLGFLMLKALPMKTSMVPRPMDLDLIFTSVSATTVSSMVAVEMESFSNSQLLLITLLMLLGGEVFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKPPPATTSPSSTLVELELAPPMDVVVVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSSSSASKTTTTRLLMFVVMGYHAVVHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTVVSTFANCGFVPTNEGMVSFRSFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPELGELLIRRRRGGGEGYHHLLPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQKLVGALFMAVNSRHSGEMVLDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSGQEGSSSSSIWQKLLMSPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGFSTGYSCARQVRPDGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKIE * pristupanje# : A2 WNZ9; * Uni Prot Sažetak : funkcija : izgleda da djeluje kao transporter natrijuma, koji reguliše K+/na+ homeostazu u izdancima recirkulacijom natrijuma od izdanaka do korijena. Izgleda da doprinosi toleranciji soli kod sorti indica Nona Bokra i Pokkali. Sudija.1subcelularna lokacija : membrana; multi-pass membranski protein vjerovatno Ref.1. Specifičnost tkiva : uglavnom izraženo u ćelijama parenhima koje graniče sa ksilemskim sudovima čvorova, internodija, baza listova, korijena i listova. Izraženo u floemu baza listova. Sudija.1indukcija : stresom soli u korijenu. Sudija.1 Domain : predlaže se da HKT transporteri sadrže 4 područja koja formiraju pore zatvorena transmembranskim segmentima od kojih svaki sadrži motiv filtera selektivnosti nalik kalijevom kanalu.Sličnosti sekvence : pripada porodici transport kalijuma Trk H. HKT (TC 2.A. 38.3) potfamilija. [Pogledaj klasifikaciju].

Deklarirane specifikacije

Dopuna robe

Rekombinantno govedo C-X-C motiv hemokin 9
  • Newbie
Ocjena robe:

Rekombinantno govedo C-X-C motiv hemokin 9

Gene Name : CXCL9 Syn Name : CXC motiv hemokin 9; mali inducibilni citokin B9; monokin induciran interferonom gama hemokin (CXC motiv) ligand 990%; informacije o oznakama : njegov tagged; na

KM 2.33
Rekombinantni Yop proteini translokacija proteina H
  • Newbie
Ocjena robe:

Rekombinantni Yop proteini translokacija proteina H

Gene Name : ysc H; yop R; lcr P;ysc H; lcr P Syn Name : izlučeni protein; Yop protein translokacija proteina H lokproteina niskog odgovora kalcijuma P vrste : Yersinia pestis; pufer za skla

KM 1.67
Rekombinantna Agelena orientalis U2-agatoxin-Ao1s
  • Newbie
Ocjena robe:

Rekombinantna Agelena orientalis U2-agatoxin-Ao1s

Gene Name : U2AGTXAo1s izvor : E Coli ili kvasac Čistoća : 90%; informacije o oznakama : PDV tagged; vrste : Agelena orientalis (Pauk) Pufer za skladištenje : PBS p H 7,4, 50% glicerol; S

KM 2.00
Rekombinantni ljudski Uroplakin-1a
  • Newbie
Ocjena robe:

Rekombinantni ljudski Uroplakin-1a

Gene Name : UPK1 A; UP1 A; UPKA; UPKA; TSPAN21 ; TSPAN21; UP1a; Tspan21; UPIa; UPKa Syn Name : rekombinantni uroplakin1a (UPK1 A); UROPLAKIN1a; UP1a; Tetraspanin21; Tspan21 uroplakin Ia UPIa

KM 43.85